ZNF264 Antibody

Images

 
Western Blot: ZNF264 Antibody [NBP1-80297] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Immunohistochemistry: ZNF264 Antibody [NBP1-80297] - Human Lung cell Cellular data: alveolar cell Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF264 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF264. Peptide sequence AAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF264
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ZNF264 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF264 Antibody

  • KIAA0412
  • zinc finger protein 264

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46379
Species: Hu
Applications: IHC, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90105
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-56316
Species: Hu
Applications: IHC, IHC-P
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
292-G2
Species: Hu
Applications: BA
H00007337-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP1-80135
Species: Hu
Applications: WB
NBP1-87299
Species: Hu
Applications: ICC/IF, WB
NBP3-09393
Species: Hu
Applications: WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-52477
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-28875
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-29373
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
NBP2-67168
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80297
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZNF264 Antibody (NBP1-80297) (0)

There are no publications for ZNF264 Antibody (NBP1-80297).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF264 Antibody (NBP1-80297) (0)

There are no reviews for ZNF264 Antibody (NBP1-80297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF264 Antibody (NBP1-80297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF264 Products

Array NBP1-80297

Bioinformatics Tool for ZNF264 Antibody (NBP1-80297)

Discover related pathways, diseases and genes to ZNF264 Antibody (NBP1-80297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF264 Antibody (NBP1-80297)

Discover more about diseases related to ZNF264 Antibody (NBP1-80297).
 

Pathways for ZNF264 Antibody (NBP1-80297)

View related products by pathway.

Research Areas for ZNF264 Antibody (NBP1-80297)

Find related products by research area.

Blogs on ZNF264

There are no specific blogs for ZNF264, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF264 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF264
Uniprot