ZNF239 Antibody (2D9)

Images

 
Western Blot: ZNF239 Antibody (2D9) [H00008187-M27] - Analysis of ZNF239 expression in transfected 293T cell line by ZNF239 monoclonal antibody (M27), clone 2D9. Lane 1: ZNF239 transfected lysate (Predicted MW: 51.6 ...read more
Immunocytochemistry/ Immunofluorescence: ZNF239 Antibody (2D9) [H00008187-M27] - Analysis of monoclonal antibody to ZNF239 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: ZNF239 Antibody (2D9) [H00008187-M27] - Analysis of monoclonal antibody to ZNF239 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml
Sandwich ELISA: ZNF239 Antibody (2D9) [H00008187-M27] - Detection limit for recombinant GST tagged ZNF239 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF239 Antibody (2D9) Summary

Immunogen
ZNF239 (NP_005665.1, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEE
Specificity
Reacts with zinc finger protein 239.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF239
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF239 Antibody (2D9)

  • KIAA1198
  • zinc finger protein 490

Background

MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997 [PubMed 9121460]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-41159
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56928
Species: Hu
Applications: WB, ICC/IF
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF1205
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
AF5596
Species: Hu
Applications: WB, IHC, ICC
H00008187-M27
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for ZNF239 Antibody (H00008187-M27) (0)

There are no publications for ZNF239 Antibody (H00008187-M27).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF239 Antibody (H00008187-M27) (0)

There are no reviews for ZNF239 Antibody (H00008187-M27). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF239 Antibody (H00008187-M27) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF239 Products

Bioinformatics Tool for ZNF239 Antibody (H00008187-M27)

Discover related pathways, diseases and genes to ZNF239 Antibody (H00008187-M27). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF239 Antibody (H00008187-M27)

Discover more about diseases related to ZNF239 Antibody (H00008187-M27).
 

Pathways for ZNF239 Antibody (H00008187-M27)

View related products by pathway.

PTMs for ZNF239 Antibody (H00008187-M27)

Learn more about PTMs related to ZNF239 Antibody (H00008187-M27).

Blogs on ZNF239

There are no specific blogs for ZNF239, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF239 Antibody (2D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF239
Entrez
Uniprot