ZNF207 Antibody (1A2)

Images

 
Western Blot: ZNF207 Antibody (1A2) [H00007756-M09] - Analysis of ZNF207 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: ZNF207 Antibody (1A2) [H00007756-M09] - Analysis of monoclonal antibody to ZNF207 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: ZNF207 Antibody (1A2) [H00007756-M09] - ZNF207 over-expressed 293 cell line, cotransfected with ZNF207 Validated Chimera RNAi or non-transfected control. Blot probed with H00007756-M09. GAPDH (36.1 kDa) ...read more
Western Blot: ZNF207 Antibody (1A2) [H00007756-M09] - Analysis of ZNF207 expression in transfected 293T cell line by ZNF207 monoclonal antibody (M09), clone 1A2. Lane 1: ZNF207 transfected lysatE (49.7 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, RNAi
Clone
1A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF207 Antibody (1A2) Summary

Immunogen
ZNF207 (NP_003448, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ
Specificity
ZNF207 - zinc finger protein 207
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF207
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein and cell lysate for WB. It has also been used for IF, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF207 Antibody (1A2)

  • DKFZp761N202
  • zinc finger protein 207

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-88925
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55268
Species: Hu
Applications: WB, IP
NB100-1300
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-30659
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56536
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37852
Species: Hu
Applications: WB
NBP2-01676
Species: Hu
Applications: WB, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-46214
Species: Hu
Applications: WB, IHC
H00007756-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi

Publications for ZNF207 Antibody (H00007756-M09) (0)

There are no publications for ZNF207 Antibody (H00007756-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF207 Antibody (H00007756-M09) (0)

There are no reviews for ZNF207 Antibody (H00007756-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF207 Antibody (H00007756-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF207 Products

Bioinformatics Tool for ZNF207 Antibody (H00007756-M09)

Discover related pathways, diseases and genes to ZNF207 Antibody (H00007756-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF207

There are no specific blogs for ZNF207, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF207 Antibody (1A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF207
Entrez
OMIM
Uniprot