ZNF174 Antibody - BSA Free

Western Blot: ZNF174 Antibody [NBP2-86443] - Host: Rabbit. Target Name: ZNF174. Sample Type: Lane: A. Jurkat. B.HepG2. Antibody Dilution: A. 2.5 ug/ml. B. 2.5ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

ZNF174 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF174 Antibody - BSA Free (NBP2-86443) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF174. Peptide sequence: MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF174
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for ZNF174 Antibody - BSA Free

• AW-1
• zinc finger protein 174
• ZSCAN8Zinc finger and SCAN domain-containing protein 8

Background

ZNF174 is a transcriptional repressor. Expressed in a variety of organs, but most strongly in adult testis and ovary followed by small intestine, colon, prostate, thymus, spleen, pancreas, skeletal muscle, heart, brain and kidney. Also expressed in umbilical vein endothelial cells, foreskin fibroblast and HEPG2 cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF174