ZNF157 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF157 Antibody [NBP1-83130] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF157 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEHLRIHTGER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF157
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF157 Protein (NBP1-83130PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF157 Antibody

  • HZF22
  • zinc finger protein 157 (HZF22)
  • zinc finger protein 157
  • zinc finger protein 22
  • Zinc finger protein HZF22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00023415-R03
Species: Hu
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-55990
Species: Hu
Applications: WB, ICC/IF
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-79990
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-00129
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83130
Species: Hu
Applications: IHC, IHC-P

Publications for ZNF157 Antibody (NBP1-83130) (0)

There are no publications for ZNF157 Antibody (NBP1-83130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF157 Antibody (NBP1-83130) (0)

There are no reviews for ZNF157 Antibody (NBP1-83130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF157 Antibody (NBP1-83130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF157 Products

Bioinformatics Tool for ZNF157 Antibody (NBP1-83130)

Discover related pathways, diseases and genes to ZNF157 Antibody (NBP1-83130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF157 Antibody (NBP1-83130)

Discover more about diseases related to ZNF157 Antibody (NBP1-83130).
 

Pathways for ZNF157 Antibody (NBP1-83130)

View related products by pathway.

PTMs for ZNF157 Antibody (NBP1-83130)

Learn more about PTMs related to ZNF157 Antibody (NBP1-83130).

Blogs on ZNF157

There are no specific blogs for ZNF157, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF157 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF157