ZNF146 Antibody


Western Blot: ZNF146 Antibody [NBP2-83827] - WB Suggested Anti-ZNF146 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human heart

Product Details

Reactivity HuSpecies Glossary
Applications WB
0.5 mg/ml

Order Details

ZNF146 Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of human ZNF146. Peptide sequence: TEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAF The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for ZNF146 Antibody

  • MGC125660
  • MGC125661
  • only zinc finger protein
  • OZF
  • zinc finger protein 146
  • zinc finger protein OZF


ZNF146 is a gene that codes for a protein that binds DNA in liver, skeletal and heart muscle, and mammary cells, which is 292 amino acids long and weighs approximately 33 kDa. Current studies are being done on diseases and disorders related to this gene including colorectal cancer, pancreatic cancer, pancreatitis, and carcinoma. ZNF146 has also been shown to have interactions with TERF2IP.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF146 Antibody (NBP2-83827) (0)

There are no publications for ZNF146 Antibody (NBP2-83827).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF146 Antibody (NBP2-83827) (0)

There are no reviews for ZNF146 Antibody (NBP2-83827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF146 Antibody (NBP2-83827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF146 Antibody and receive a gift card or discount.


Gene Symbol ZNF146