ZNDR1 Antibody


Immunocytochemistry/ Immunofluorescence: ZNDR1 Antibody [NBP2-55396] - Staining of human cell line PC-3 shows localization to nucleoli fibrillar center.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

ZNDR1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCT
Specificity of human ZNDR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNDR1 Recombinant Protein Antigen (NBP2-55396PEP)

Reactivity Notes

Mouse 82%, Rat 84%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ZNDR1 Antibody

  • DNA-directed RNA polymerase I subunit RPA12
  • HTEX-6
  • hZR14
  • MGC13376
  • RNA polymerase I small specific subunit Rpa12
  • Rpa12
  • tctex-6
  • TEX6
  • transcription-associated zinc ribbon protein
  • zinc ribbon domain containing 1
  • zinc ribbon domain containing, 1
  • Zinc ribbon domain-containing protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: Flow, IP, CyTOF-ready
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF

Publications for ZNDR1 Antibody (NBP2-55396) (0)

There are no publications for ZNDR1 Antibody (NBP2-55396).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNDR1 Antibody (NBP2-55396) (0)

There are no reviews for ZNDR1 Antibody (NBP2-55396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNDR1 Antibody (NBP2-55396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNDR1 Antibody (NBP2-55396)

Discover related pathways, diseases and genes to ZNDR1 Antibody (NBP2-55396). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNDR1 Antibody (NBP2-55396)

Discover more about diseases related to ZNDR1 Antibody (NBP2-55396).

Pathways for ZNDR1 Antibody (NBP2-55396)

View related products by pathway.

PTMs for ZNDR1 Antibody (NBP2-55396)

Learn more about PTMs related to ZNDR1 Antibody (NBP2-55396).

Blogs on ZNDR1

There are no specific blogs for ZNDR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNDR1 Antibody and receive a gift card or discount.


Gene Symbol ZNRD1