ZKSCAN1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ZKSCAN1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZKSCAN1.
  
  

  Source: E. coli

  Amino Acid Sequence: NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ZKSCAN1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81346.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZKSCAN1 Recombinant Protein Antigen

• KOX189130423L19Rik
• PHZ-37
• Zinc finger protein 139
• zinc finger protein 36 (KOX 18)
• Zinc finger protein 36
• Zinc finger protein KOX18
• zinc finger protein with KRAB and SCAN domains 1
• zinc finger with KRAB and SCAN domains 1
• ZNF139
• ZNF36MGC138429

Background

ZKSCAN1 is a zinc-finger protein that contains six C2H2-type zinc fingers, a SCAN box domain, and a KRAB (kruppel-associated box) domain. Due to its structure, the function of ZKSCAN1is predicted to be involved in transcription. The KRAB domain is found in many C2H2-type zinc fingers and may be involved in mediating protein-protein reactions. The SCAN domain (named after SRE-ZBP, CTfin51, AW-1, and Number 18 cDNA) may also be involved in protein interactions due to its ability to mediate homo- and hetero-oligomerization. Alternative names for ZKSCAN1 include zinc finger protein with KRAB and SCAN domains 1, KOX18, ZNF139, ZNF36, and PHZ-37.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ZKSCAN1