Zinc finger protein 470 Antibody

Immunocytochemistry/Immunofluorescence: Zinc finger protein 470 Antibody [NBP1-84324] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.

Immunohistochemistry-Paraffin: Zinc finger protein 470 Antibody [NBP1-84324] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Zinc finger protein 470 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KDPWVIKGGMNRGLCPDLECVWVTKSLSLNQDIYEEKLPPAIIMERLKSYDLECSTLGKNWKCEDLFE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF470
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Zinc finger protein 470 Protein (NBP1-84324PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Zinc finger protein 470 Antibody

• chondrogenesis zinc finger protein 1
• CZF1
• CZF-1
• FLJ26175
• FLJ26846
• zinc finger protein 470

Background

Zinc finger protein 470 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF470