Zinc finger protein 470 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Zinc finger protein 470 Antibody [NBP1-84324] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: Zinc finger protein 470 Antibody [NBP1-84324] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Zinc finger protein 470 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDPWVIKGGMNRGLCPDLECVWVTKSLSLNQDIYEEKLPPAIIMERLKSYDLECSTLGKNWKCEDLFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF470
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Zinc finger protein 470 Protein (NBP1-84324PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Zinc finger protein 470 Antibody

  • chondrogenesis zinc finger protein 1
  • CZF1
  • CZF-1
  • FLJ26175
  • FLJ26846
  • zinc finger protein 470

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83997
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46395
Species: Hu
Applications: WB, IHC
NBP2-58960
Species: Hu
Applications: WB, ICC/IF
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NBP1-31330
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-87320
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF
NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57758
Species: Hu
Applications: ICC/IF
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84324
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Zinc finger protein 470 Antibody (NBP1-84324) (0)

There are no publications for Zinc finger protein 470 Antibody (NBP1-84324).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zinc finger protein 470 Antibody (NBP1-84324) (0)

There are no reviews for Zinc finger protein 470 Antibody (NBP1-84324). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Zinc finger protein 470 Antibody (NBP1-84324) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zinc finger protein 470 Products

Bioinformatics Tool for Zinc finger protein 470 Antibody (NBP1-84324)

Discover related pathways, diseases and genes to Zinc finger protein 470 Antibody (NBP1-84324). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zinc finger protein 470 Antibody (NBP1-84324)

Discover more about diseases related to Zinc finger protein 470 Antibody (NBP1-84324).
 

Pathways for Zinc finger protein 470 Antibody (NBP1-84324)

View related products by pathway.

Blogs on Zinc finger protein 470

There are no specific blogs for Zinc finger protein 470, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zinc finger protein 470 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF470