Recombinant Human ZIC3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZIC3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 182-274 of Human ZIC3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZIC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZIC3 GST (N-Term) Protein

  • Heterotaxy 1
  • HTX1
  • HTXHTX1
  • Zic family member 3 (odd-paired homolog, Drosophila)
  • ZIC3
  • Zinc finger protein 203
  • zinc finger protein ZIC 3
  • ZNF203
  • ZNF203Zinc finger protein of the cerebellum 3

Background

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-488
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-24607
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
AF339
Species: Hu
Applications: Block, IHC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
3218-ND/CF
Species: Hu
Applications: BA
746-LF/CF
Species: Hu
Applications: BA
MAB18401
Species: Mu
Applications: CyTOF-ready, Flow, ICC
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
DVE00
Species: Hu
Applications: ELISA
AF7388
Species: Hu
Applications: IHC
H00084107-M09
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
1845-SH/CF
Species: Hu
Applications: BA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
314-BP/CF
Species: Hu
Applications: BA, BA
H00007547-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ZIC3 Partial Recombinant Protein (H00007547-Q01) (0)

There are no publications for ZIC3 Partial Recombinant Protein (H00007547-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZIC3 Partial Recombinant Protein (H00007547-Q01) (0)

There are no reviews for ZIC3 Partial Recombinant Protein (H00007547-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZIC3 Partial Recombinant Protein (H00007547-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZIC3 Products

Bioinformatics Tool for ZIC3 Partial Recombinant Protein (H00007547-Q01)

Discover related pathways, diseases and genes to ZIC3 Partial Recombinant Protein (H00007547-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZIC3 Partial Recombinant Protein (H00007547-Q01)

Discover more about diseases related to ZIC3 Partial Recombinant Protein (H00007547-Q01).
 

Pathways for ZIC3 Partial Recombinant Protein (H00007547-Q01)

View related products by pathway.

PTMs for ZIC3 Partial Recombinant Protein (H00007547-Q01)

Learn more about PTMs related to ZIC3 Partial Recombinant Protein (H00007547-Q01).
 

Research Areas for ZIC3 Partial Recombinant Protein (H00007547-Q01)

Find related products by research area.

Blogs on ZIC3

There are no specific blogs for ZIC3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZIC3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZIC3