ZFYVE9 Recombinant Protein Antigen

Images

 
There are currently no images for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZFYVE9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZFYVE9.

Source: E. coli

Amino Acid Sequence: NHLCPTSSDSLASVCSPSQLKDDGSIGRDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTDLGSPN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZFYVE9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57583.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZFYVE9 Recombinant Protein Antigen

  • Madh-interacting protein
  • MADHIP
  • mothers against decapentaplegic homolog interacting protein
  • mothers against decapentaplegic homolog interacting protein, receptoractivation anchor
  • NSP
  • Receptor activation anchor
  • SARAhSARA
  • Smad anchor for receptor activation
  • SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein
  • zinc finger FYVE domain-containing protein 9
  • zinc finger, FYVE domain containing 9

Background

ZFYVE9 encodes a double zinc finger (FYVE domain) protein that interacts directly with SMAD2 and SMAD3, and is involved in Alzheimer's disease. SMAD proteins transmit signals from transmembrane serine/threonine kinase receptors to the nucleus. The FYVE domain has been identified in a number of unrelated signaling molecules. This protein functions to recruit SMAD2 to the transforming growth factor-beta receptor. The FYVE domain is required to maintain the normal localization of this protein but is not involved in mediating interaction with SMADs. The C-terminal domain of this protein interacts with the TGFB receptor. This protein is a component of the TGFB pathway that brings the SMAD substrate to the receptor. Three alternatively spliced transcripts encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81516
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-97677
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2097
Species: Hu
Applications: ChIP, ICC, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NBP1-83202
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NBP1-84957
Species: Hu
Applications: IHC,  IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-25371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP) (0)

There are no publications for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP) (0)

There are no reviews for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFYVE9 Products

Research Areas for ZFYVE9 Recombinant Protein Antigen (NBP2-57583PEP)

Find related products by research area.

Blogs on ZFYVE9

There are no specific blogs for ZFYVE9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZFYVE9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFYVE9