ZFX Antibody - BSA Free

Immunohistochemistry-Paraffin: ZFX Antibody [NBP1-80583] - Staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.

Immunohistochemistry-Paraffin: ZFX Antibody [NBP1-80583] - Human duodenum shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: ZFX Antibody [NBP1-80583] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: ZFX Antibody [NBP1-80583] - Staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: ZFX Antibody [NBP1-80583] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZFX Antibody - BSA Free Summary

• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IGPDGHPLTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHL
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZFX Recombinant Protein Antigen (NBP1-80583PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZFX Antibody - BSA Free

• zinc finger protein, X-linked

Background

Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZFX Antibody (NBP1-80583)(1)

Publication using NBP1-80583

• Latif A, Fisher LE, Dundas AA et al. Microparticles Decorated with Cell-Instructive Surface Chemistries Actively Promote Wound Healing Advanced materials (Deerfield Beach, Fla.) 2022-11-28 [PMID: 36440539] (IHC-P, Human)

Bioinformatics

• Gene Symbol: ZFX
• Entrez:
  • 7543(Human)
• Uniprot:
  • P17010(Human)