ZFPL1 Antibody - BSA Free

Western Blot: ZFPL1 Antibody [NBP1-85347] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ZFPL1 antibody. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: ZFPL1 Antibody [NBP1-85347] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human pancreas using Anti-ZFPL1 antibody NBP1-85347.

Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human cerebral cortex, colon, pancreas and testis using Anti-ZFPL1 antibody NBP1-85347 (A) shows similar protein distribution across tissues to independent antibody NBP1-85346 (B).

Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human testis.

Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human fallopian tube shows moderate to strong positivity in golgi apparatus in glandular cells.

Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human small intestine shows moderate to strong positivity in golgi apparatus in glandular cells.

Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human colon.

Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human cerebral cortex using Anti-ZFPL1 antibody NBP1-85347.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZFPL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFPL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF reported in scientific literature (PMID: 25359980). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZFPL1 Protein (NBP1-85347PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Human reactivity reported in scientific literature (PMID: 25359980).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZFPL1 Antibody - BSA Free

• D11S750
• MCG4
• Zinc finger protein MCG4
• zinc finger protein-like 1
• zinc-finger protein in MEN1 region

Background

ZFPL1 is required for cis-Golgi integrity and efficient ER to Golgi transport. Involved in the maintainance of the integrity of the cis-Golgi, possibly via its interaction with GOLGA2/GM130

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZFPL1 Antibody (NBP1-85347)(1)

Publication using NBP1-85347

• Wong M, Munro S. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science 2014-10-31 [PMID: 25359980] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: ZFPL1