ZFPL1 Antibody

Images

 
Western Blot: ZFPL1 Antibody [NBP1-85347] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ZFPL1 Antibody [NBP1-85347] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: ZFPL1 Antibody [NBP1-85347] - Staining of human pancreas shows strong cytoplasmic positivity in granular pattern in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, ICC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFPL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFPL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunocytochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFPL1 Protein (NBP1-85347PEP)
Publications
Read Publication using
NBP1-85347 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%). Human reactivity reported in scientific literature (PMID: 25359980).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFPL1 Antibody

  • D11S750
  • MCG4
  • Zinc finger protein MCG4
  • zinc finger protein-like 1
  • zinc-finger protein in MEN1 region

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
MAB5756
Species: Hu
Applications: Flow
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56355
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90189
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-81610
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZFPL1 Antibody (NBP1-85347)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ZFPL1 Antibody (NBP1-85347) (0)

There are no reviews for ZFPL1 Antibody (NBP1-85347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZFPL1 Antibody (NBP1-85347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFPL1 Products

Bioinformatics Tool for ZFPL1 Antibody (NBP1-85347)

Discover related pathways, diseases and genes to ZFPL1 Antibody (NBP1-85347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFPL1 Antibody (NBP1-85347)

Discover more about diseases related to ZFPL1 Antibody (NBP1-85347).
 

Pathways for ZFPL1 Antibody (NBP1-85347)

View related products by pathway.

Blogs on ZFPL1

There are no specific blogs for ZFPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFPL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFPL1