ZFP37 Antibody

Images

 
Western Blot: ZFP37 Antibody [NBP2-86415] - WB Suggested Anti-ZFP37 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysateZFP37 is supported by BioGPS gene expression data to be ...read more

Product Details

Summary
Reactivity Hu, Bv, CaSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFP37 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZFP37. Peptide sequence: LCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Bovine (92%), Canine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ZFP37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFP37 Antibody

  • dJ734P14.5
  • FLJ39592
  • MGC10715
  • MGC20504
  • zinc finger protein 343

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
H00001647-M01
Species: Hu
Applications: WB, Simple Western, ELISA, IHC, IHC-P, PLA
MAB5809
Species: Hu
Applications: WB
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-80410
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, IHC, IHC-P
AF1042
Species: Mu
Applications: WB, IHC
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-86962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP, ICC

Publications for ZFP37 Antibody (NBP2-86415) (0)

There are no publications for ZFP37 Antibody (NBP2-86415).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP37 Antibody (NBP2-86415) (0)

There are no reviews for ZFP37 Antibody (NBP2-86415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFP37 Antibody (NBP2-86415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZFP37 Products

Bioinformatics Tool for ZFP37 Antibody (NBP2-86415)

Discover related pathways, diseases and genes to ZFP37 Antibody (NBP2-86415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP37 Antibody (NBP2-86415)

Discover more about diseases related to ZFP37 Antibody (NBP2-86415).
 

Pathways for ZFP37 Antibody (NBP2-86415)

View related products by pathway.

Blogs on ZFP37

There are no specific blogs for ZFP37, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFP37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP37