Zfp275 Antibody

Images

 
Western Blot: Zfp275 Antibody [NBP1-91319] - Lane: Mouse Kidney Lysate, ANtobody Titration is 1 ug/ml and Gel concentration is 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Zfp275 Antibody Summary

Immunogen
The specific Immunogen is proprietary information. Peptide sequence LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
Zfp275
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Zfp275 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Zfp275 Antibody

  • DXBay20
  • zinc finger protein 275

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
H00000518-R01
Species: Hu
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
NBP1-87499
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54731
Species: Hu
Applications: WB, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Zfp275 Antibody (NBP1-91319) (0)

There are no publications for Zfp275 Antibody (NBP1-91319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zfp275 Antibody (NBP1-91319) (0)

There are no reviews for Zfp275 Antibody (NBP1-91319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Zfp275 Antibody (NBP1-91319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zfp275 Products

Zfp275 NBP1-91319

Bioinformatics Tool for Zfp275 Antibody (NBP1-91319)

Discover related pathways, diseases and genes to Zfp275 Antibody (NBP1-91319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Zfp275

There are no specific blogs for Zfp275, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zfp275 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Zfp275
Uniprot