ZFP106 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZFP106 Antibody [NBP2-13543] - Immunofluorescent staining of human cell line HeLa shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: ZFP106 Antibody [NBP2-13543] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFP106 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSGWHKGVAGGSSTWFHNHSNSGGGWLSNSGAVDWNHNGTGRNSSWLSEG TGGFSSWHMNNSNGNWKSSVRSTNNWNYSGPGDKFQPGRNRNSNCQMEDM TMLWNKKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSEGFTSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFP106
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFP106 Protein (NBP2-13543PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFP106 Antibody

  • DKFZp451A239
  • FLJ34610
  • SH3BP3
  • SH3-domain binding protein 3
  • zfp-106
  • zinc finger protein 106 homolog (mouse)
  • zinc finger protein 106 homolog
  • Zinc finger protein 474
  • ZNF474FLJ45841

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZFP106 Antibody (NBP2-13543) (0)

There are no publications for ZFP106 Antibody (NBP2-13543).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP106 Antibody (NBP2-13543) (0)

There are no reviews for ZFP106 Antibody (NBP2-13543). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZFP106 Antibody (NBP2-13543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFP106 Products

Bioinformatics Tool for ZFP106 Antibody (NBP2-13543)

Discover related pathways, diseases and genes to ZFP106 Antibody (NBP2-13543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP106 Antibody (NBP2-13543)

Discover more about diseases related to ZFP106 Antibody (NBP2-13543).
 

Pathways for ZFP106 Antibody (NBP2-13543)

View related products by pathway.

Blogs on ZFP106

There are no specific blogs for ZFP106, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFP106 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP106