ZCRB1 Antibody - BSA Free

Western Blot: ZCRB1 Antibody [NBP3-10542] - Western blot analysis using NBP3-10542 on Human Spleen as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZCRB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZCRB1 Antibody - BSA Free (NBP3-10542) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZCRB1 (NP_149105). Peptide sequence MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZCRB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZCRB1 Antibody - BSA Free

• MADP-1
• MADP1U11/U12 snRNP 31 kDa protein
• MGC26805
• RBM36
• U11/U12 small nuclear ribonucleoprotein 31 kDa protein
• U11/U12 snRNP 31K
• U11/U12-31K
• ZCCHC19
• zinc finger CCHC-type and RNA binding motif 1
• zinc finger CCHC-type and RNA-binding motif-containing protein 1

Background

Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognizes the 5' splice site and branch-point sequence. U11 and U12 snRNPs are components of U12-type spliceosome and function as a molecular bridge connecting both ends of the intron. The protein encoded by this gene contains a RNA recognition motif. It was identified as one of the protein components of U11/U12 snRNPs. This protein and many other U11/U12 snRNP proteins are highly conserved in organisms known to contain U12-type introns. These proteins have been shown to be essential for cell viability, suggesting the key roles in U12-type splicing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZCRB1