ZCCHC12 Antibody - BSA Free

Western Blot: ZCCHC12 Antibody [NBP2-33943] - Analysis in control (vector only transfected HEK293T lysate) and ZCCHC12 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ZCCHC12 Antibody [NBP2-33943] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.

Immunohistochemistry-Paraffin: ZCCHC12 Antibody [NBP2-33943] - Staining of human hippocampus shows distinct nucleolar positivity in neuronal cells.

Product Discontinued

ZCCHC12 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZCCHC12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZCCHC12 Antibody - BSA Free

• FLJ16123
• SIZN
• SIZN12810028A01Rik
• Smad-interacting zinc finger protein 1
• zinc finger CCHC domain-containing protein 12
• zinc finger, CCHC domain containing 12

Background

Transcriptional coactivator in the bone morphogenetic protein (BMP)-signaling pathway. It positivelymodulates BMP signaling by interacting with SMAD1 and associating with CBP in the transcription complex. Itcontributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZCCHC12
• Uniprot:
  • Q6PEW1(Human)