ZBTB46 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZBTB46 Antibody [NBP1-88506] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: ZBTB46 Antibody [NBP1-88506] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBTB46 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QACHDFIKAALDISIKSDASDELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGGSELPSAKDGAVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB46
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZBTB46 Protein (NBP1-88506PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZBTB46 Antibody

  • BTB (POZ) domain containing 4
  • BTB/POZ domain-containing protein 4
  • BTBD4
  • dJ583P15.7
  • dJ583P15.8
  • FLJ13502
  • RINZF
  • zinc finger and BTB domain containing 46
  • zinc finger and BTB domain-containing protein 46
  • Zinc finger protein 340
  • ZNF340

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86688
Species: Hu
Applications: IHC, IHC-P
NBP1-31129
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
259-HE
Species: Hu
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-89369
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47324
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84046
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88506
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ZBTB46 Antibody (NBP1-88506) (0)

There are no publications for ZBTB46 Antibody (NBP1-88506).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBTB46 Antibody (NBP1-88506) (0)

There are no reviews for ZBTB46 Antibody (NBP1-88506). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZBTB46 Antibody (NBP1-88506) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBTB46 Products

Bioinformatics Tool for ZBTB46 Antibody (NBP1-88506)

Discover related pathways, diseases and genes to ZBTB46 Antibody (NBP1-88506). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBTB46 Antibody (NBP1-88506)

Discover more about diseases related to ZBTB46 Antibody (NBP1-88506).

PTMs for ZBTB46 Antibody (NBP1-88506)

Learn more about PTMs related to ZBTB46 Antibody (NBP1-88506).

Blogs on ZBTB46

There are no specific blogs for ZBTB46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB46 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB46