ZBTB4 Antibody

Images

 
Western Blot: ZBTB4 Antibody [NBP2-86404] - WB Suggested Anti-ZBTB4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: 293T cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBTB4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human ZBTB4. Peptide sequence: PFLPGVFGYAVNPQAAPPAPPTPPPPTLPPPIPPKGEGERAGVERTQKGD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZBTB4 Antibody

  • KAISO-L1
  • zinc finger and BTB domain containing 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP1-87866
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-97665
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4256
Species: Hu
Applications: WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5784
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-83714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DMP700
Species: Hu
Applications: ELISA
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NB110-60490
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-86404
Species: Hu
Applications: WB

Publications for ZBTB4 Antibody (NBP2-86404) (0)

There are no publications for ZBTB4 Antibody (NBP2-86404).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBTB4 Antibody (NBP2-86404) (0)

There are no reviews for ZBTB4 Antibody (NBP2-86404). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZBTB4 Antibody (NBP2-86404) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBTB4 Products

Array NBP2-86404

Bioinformatics Tool for ZBTB4 Antibody (NBP2-86404)

Discover related pathways, diseases and genes to ZBTB4 Antibody (NBP2-86404). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBTB4 Antibody (NBP2-86404)

Discover more about diseases related to ZBTB4 Antibody (NBP2-86404).
 

Pathways for ZBTB4 Antibody (NBP2-86404)

View related products by pathway.

PTMs for ZBTB4 Antibody (NBP2-86404)

Learn more about PTMs related to ZBTB4 Antibody (NBP2-86404).
 

Research Areas for ZBTB4 Antibody (NBP2-86404)

Find related products by research area.

Blogs on ZBTB4

There are no specific blogs for ZBTB4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB4