We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ZAK Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related ZAK Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-90367PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZAK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZAK.

Source: E. coli

Amino Acid Sequence: FHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZAK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90367.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZAK Recombinant Protein Antigen

  • AZK
  • EC 2.7.11
  • EC 2.7.11.25
  • HCCS-4
  • Human cervical cancer suppressor gene 4 protein
  • Leucine zipper- and sterile alpha motif-containing kinase
  • mitogen-activated protein kinase kinase kinase MLT
  • mixed lineage kinase 7
  • mixed lineage kinase with a leucine zipper and a sterile alpha motif
  • mixed lineage kinase-related kinase MRK-beta
  • Mixed lineage kinase-related kinase
  • MLK7
  • mlklak
  • MLK-like mitogen-activated protein triple kinase
  • MLK-related kinase
  • MLT
  • MLTK
  • MRKcervical cancer suppressor gene 4 protein
  • pk
  • protein kinase
  • sterile alpha motif and leucine zipper containing kinase AZK
  • Sterile alpha motif- and leucine zipper-containing kinase AZK

Background

ZAK is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
202-IL
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1396
Species: Hu
Applications: WB
AF2498
Species: Mu
Applications: IP, WB
4308-SE
Species: Hu
Applications: EnzAct
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF842
Species: Hu
Applications: ELISA, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-88262
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-92873
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF3428
Species: Hu
Applications: ICC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for ZAK Protein (NBP1-90367PEP) (0)

There are no publications for ZAK Protein (NBP1-90367PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZAK Protein (NBP1-90367PEP) (0)

There are no reviews for ZAK Protein (NBP1-90367PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZAK Protein (NBP1-90367PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZAK Products

Array NBP1-90367PEP

Research Areas for ZAK Protein (NBP1-90367PEP)

Find related products by research area.

Blogs on ZAK

There are no specific blogs for ZAK, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZAK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZAK