YIPF6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: YIPF6 Antibody [NBP1-90457] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry: YIPF6 Antibody [NBP1-90457] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YIPF6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YIPF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
YIPF6 Protein (NBP1-90457PEP)
Publications
Read Publication using NBP1-90457.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YIPF6 Antibody

  • Yip1 domain family, member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H7431-00
Species: Hu
Applications: WB
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-86720
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-88828
Species: Hu
Applications: IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87399
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38921
Species: Hu
Applications: IHC, IHC-P
NBP2-32567
Species: Hu
Applications: IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P

Publications for YIPF6 Antibody (NBP1-90457)(1)

Reviews for YIPF6 Antibody (NBP1-90457) (0)

There are no reviews for YIPF6 Antibody (NBP1-90457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for YIPF6 Antibody (NBP1-90457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional YIPF6 Products

YIPF6 NBP1-90457

Bioinformatics Tool for YIPF6 Antibody (NBP1-90457)

Discover related pathways, diseases and genes to YIPF6 Antibody (NBP1-90457). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YIPF6 Antibody (NBP1-90457)

Discover more about diseases related to YIPF6 Antibody (NBP1-90457).
 

Pathways for YIPF6 Antibody (NBP1-90457)

View related products by pathway.

Blogs on YIPF6

There are no specific blogs for YIPF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YIPF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YIPF6