YIPF6 Antibody (6X1R7)

Western Blot: YIPF6 Antibody (6X1R7) [NBP3-33490] - Western Blot analysis of lysates from Mouse placenta using YIPF6 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Mu
• Applications: WB, ELISA
• Clone: 6X1R7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

YIPF6 Antibody (6X1R7) Summary

• Description: Novus Biologicals Rabbit YIPF6 Antibody (6X1R7) (NBP3-33490) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of mouse YIPF6 (NP_997516.1).
  
  Sequence:
  MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRARAQEHDSSTLNESIRRTIMRDLKAVGRKFMHVLYPRKSN
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for YIPF6 Antibody (6X1R7)

• Yip1 domain family, member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.