![Immunocytochemistry/Immunofluorescence: YIPF3 Antibody [NBP1-86765] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.](http://images.novusbio.com/fullsize/YIPF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86765-img0007.jpg "Immunocytochemistry/Immunofluorescence: YIPF3 Antibody [NBP1-86765] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit YIPF3 Antibody - BSA Free (NBP1-86765) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-YIPF3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | YIPF3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
| Publication using NBP1-86765 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Armen Petrosyan |
WB | Human | 11/06/2024 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | YIPF3 |
![Immunohistochemistry-Paraffin: YIPF3 Antibody [NBP1-86765] - Staining of human epididymis shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/YIPF3-Antibody-Immunohistochemistry-Paraffin-NBP1-86765-img0006.jpg "Immunohistochemistry-Paraffin: YIPF3 Antibody [NBP1-86765] - Staining of human epididymis shows cytoplasmic positivity in glandular cells.")
![Western Blot: Rabbit Polyclonal YIPF3 Antibody [NBP1-86765] - YIPF3 W-B of the lysate VA-13 cells (mouse ADH1-transfected HepG2 cells): control, alcohol-treated. treated with YIPF3 siRNAs, and alcohol plus YIPF3 siRNAs. Beta-actin is a loading control. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-86765_rabbit-polyclonal-yipf3-antibody-western-blot-11112024101422..jpg "Western Blot: Rabbit Polyclonal YIPF3 Antibody [NBP1-86765] - YIPF3 W-B of the lysate VA-13 cells (mouse ADH1-transfected HepG2 cells): control, alcohol-treated. treated with YIPF3 siRNAs, and alcohol plus YIPF3 siRNAs. Beta-actin is a loading control. Image from a verified customer review.")
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
