YIF1A Antibody

Images

 
Western Blot: YIF1A Antibody [NBP1-89362] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: YIF1A Antibody [NBP1-89362] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Western Blot: YIF1A Antibody [NBP1-89362] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: YIF1A Antibody [NBP1-89362] - Staining of human colon strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: YIF1A Antibody [NBP1-89362] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: YIF1A Antibody [NBP1-89362] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YIF1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Specificity
Specificity of human YIF1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YIF1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
YIF1A Knockout 293T Cell Lysate
Control Peptide
YIF1A Protein (NBP1-89362PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YIF1A Antibody

  • 54TMp
  • 54TMYIF1protein YIF1A
  • FinGER7
  • HYIF1P
  • putative Rab5-interacting protein
  • putative transmembrane protein 54TMp
  • YIF1P
  • Yip1 interacting factor homolog (S. cerevisiae)
  • Yip1 interacting factor homolog A (S. cerevisiae)
  • YIP1-interacting factor homolog A
  • Yip1p-interacting factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57970
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-89025
Species: Hu, Rt, Po, Ca, Ch, Ha, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-97649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86765
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-20261
Species: Hu
Applications: WB, ICC/IF
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB6544
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-79800
Species: Hu
Applications: WB
NBP2-45788
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75545
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1397
Species: Hu, Mu, Rt, Ca, Ch, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89362
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for YIF1A Antibody (NBP1-89362) (0)

There are no publications for YIF1A Antibody (NBP1-89362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YIF1A Antibody (NBP1-89362) (0)

There are no reviews for YIF1A Antibody (NBP1-89362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for YIF1A Antibody (NBP1-89362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional YIF1A Products

Bioinformatics Tool for YIF1A Antibody (NBP1-89362)

Discover related pathways, diseases and genes to YIF1A Antibody (NBP1-89362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YIF1A Antibody (NBP1-89362)

Discover more about diseases related to YIF1A Antibody (NBP1-89362).
 

Pathways for YIF1A Antibody (NBP1-89362)

View related products by pathway.

Blogs on YIF1A

There are no specific blogs for YIF1A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YIF1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YIF1A
Entrez
Uniprot