YIF1A Antibody

Images

 
Western Blot: YIF1A Antibody [NBP1-89362] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: YIF1A Antibody [NBP1-89362] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Western Blot: YIF1A Antibody [NBP1-89362] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YIF1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YIF1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
YIF1A Protein (NBP1-89362PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YIF1A Antibody

  • 54TMp
  • 54TMYIF1protein YIF1A
  • FinGER7
  • HYIF1P
  • putative Rab5-interacting protein
  • putative transmembrane protein 54TMp
  • YIF1P
  • Yip1 interacting factor homolog (S. cerevisiae)
  • Yip1 interacting factor homolog A (S. cerevisiae)
  • YIP1-interacting factor homolog A
  • Yip1p-interacting factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57970
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-43782
Species: Hu
Applications: WB
NBP2-47379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84684
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86765
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB6544
Species: Hu
Applications: IHC
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NBP1-89362
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for YIF1A Antibody (NBP1-89362) (0)

There are no publications for YIF1A Antibody (NBP1-89362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YIF1A Antibody (NBP1-89362) (0)

There are no reviews for YIF1A Antibody (NBP1-89362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for YIF1A Antibody (NBP1-89362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional YIF1A Products

Bioinformatics Tool for YIF1A Antibody (NBP1-89362)

Discover related pathways, diseases and genes to YIF1A Antibody (NBP1-89362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YIF1A Antibody (NBP1-89362)

Discover more about diseases related to YIF1A Antibody (NBP1-89362).
 

Pathways for YIF1A Antibody (NBP1-89362)

View related products by pathway.

Blogs on YIF1A

There are no specific blogs for YIF1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YIF1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YIF1A
Entrez
Uniprot