![Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Analysis in human placenta and skeletal muscle tissues using NBP2-57970 antibody. Corresponding YIPF5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/YIPF5-Antibody-Immunohistochemistry-Paraffin-NBP2-57970-img0005.jpg "Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Analysis in human placenta and skeletal muscle tissues using NBP2-57970 antibody. Corresponding YIPF5 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD |
| Predicted Species | Mouse (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | YIPF5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | YIPF5 |
![Western Blot: YIPF5 Antibody [NBP2-57970] - Analysis in human cell line U-2197.](http://images.novusbio.com/fullsize/YIPF5-Antibody-Western-Blot-NBP2-57970-img0010.jpg "Western Blot: YIPF5 Antibody [NBP2-57970] - Analysis in human cell line U-2197.")
![Immunocytochemistry/Immunofluorescence: YIPF5 Antibody [NBP2-57970] - Staining of human cell line BJ shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/YIPF5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57970-img0001.jpg "Immunocytochemistry/Immunofluorescence: YIPF5 Antibody [NBP2-57970] - Staining of human cell line BJ shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/YIPF5-Antibody-Immunohistochemistry-Paraffin-NBP2-57970-img0009.jpg "Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/YIPF5-Antibody-Immunohistochemistry-Paraffin-NBP2-57970-img0006.jpg "Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/YIPF5-Antibody-Immunohistochemistry-Paraffin-NBP2-57970-img0007.jpg "Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/YIPF5-Antibody-Immunohistochemistry-Paraffin-NBP2-57970-img0008.jpg "Immunohistochemistry-Paraffin: YIPF5 Antibody [NBP2-57970] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.")
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Flow Cytometry KIR2DL3/CD158b2 Antibody (180701) [Unconjugated]](https://images.novusbio.com/images2/KIR2DL3_MAB2014_Flow_Cytometry_23697.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")