Recombinant Human YB1 Protein

Product Discontinued

Recombinant Human YB1 Protein Summary

• Description: Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 324 of Human YBX1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: YBX1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 62.3 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human YB1 Protein

• BP-8
• CBF-A
• class II, Y box-binding protein I
• CSDA2
• CSDB
• DBPB CCAAT-binding transcription factor I subunit A
• EFI-A
• Enhancer factor I subunit A
• MDR-NF1
• MGC104858
• MGC110976
• MGC117250
• NSEP1 Y-box-binding protein 1
• nuclease-sensitive element-binding protein 1
• Y box binding protein 1
• YB1 DNA-binding protein B
• YB-1 Y-box transcription factor
• YBX1

Background

The Y-box binding protein 1 (YB1) is a pluripotent DNA/RNA-binding factor which regulates gene expression through transcription and translation. YB1 has been shown to be a marker of tumor aggressiveness and belongs to the cold-shock domain family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for YB1 Recombinant Protein (H00004904-P01)(1)

Publication using H00004904-P01

• Dhawan L, Liu B, Pytlak A et al. Y-box binding protein-1 and Ribonuclease UK114 mediate MCP-1 mRNA stability in vascular smooth muscle cells. Mol Cell Biol 2012-07-31 [PMID: 22801372] (Rat)

FAQs for YB1 Recombinant Protein (H00004904-P01). (Showing 1 - 1 of 1 FAQ).

1. I am ordering your product YB1 Recombinant Protein, H00004904-P01. I am going to use this product for checking its activity (ability to bind RNA) in translation assay experiments. I would like to know the following technical information about this product: 1) Is the recombinant protein is active? 2) Which condition is the protein is purified: native or denaturing? 3) Please provide a reference/s on the use of this product in case it is available.
   • The answers to your questions are as follows: 1) This recombinant protein has not been tested for any functionality; we therefore recommend that it is not used for experiments requiring activity. 2) The method of protein purification used is Glutathione Sepharose 4 Fast Flow; the tagged proteins are eluted under mild, non-denaturing conditions. 3) Here is a MCB reference for H00004904-P01 (where the manufacturer is shown as Abnova, the Taiwanese company we distribute this product for).

Bioinformatics

• Gene Symbol: YBX1