Recombinant Human YB1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related YB1 Peptides and Proteins

Order Details


    • Catalog Number
      H00004904-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human YB1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 324 of Human YBX1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
YBX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
62.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004904-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human YB1 Protein

  • BP-8
  • CBF-A
  • class II, Y box-binding protein I
  • CSDA2
  • CSDB
  • DBPB CCAAT-binding transcription factor I subunit A
  • EFI-A
  • Enhancer factor I subunit A
  • MDR-NF1
  • MGC104858
  • MGC110976
  • MGC117250
  • NSEP1 Y-box-binding protein 1
  • nuclease-sensitive element-binding protein 1
  • Y box binding protein 1
  • YB1 DNA-binding protein B
  • YB-1 Y-box transcription factor
  • YBX1

Background

The Y-box binding protein 1 (YB1) is a pluripotent DNA/RNA-binding factor which regulates gene expression through transcription and translation. YB1 has been shown to be a marker of tumor aggressiveness and belongs to the cold-shock domain family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004782-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-81407
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81000
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NBP1-84999
Species: Hu
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
NBP2-15039
Species: Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
H00004904-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for YB1 Recombinant Protein (H00004904-P01)(1)

We have publications tested in 1 confirmed species: Rat.


Filter By Application
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for YB1 Recombinant Protein (H00004904-P01) (0)

There are no reviews for YB1 Recombinant Protein (H00004904-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for YB1 Recombinant Protein (H00004904-P01). (Showing 1 - 1 of 1 FAQ).

  1. I am ordering your product YB1 Recombinant Protein, H00004904-P01. I am going to use this product for checking its activity (ability to bind RNA) in translation assay experiments. I would like to know the following technical information about this product: 1) Is the recombinant protein is active? 2) Which condition is the protein is purified: native or denaturing? 3) Please provide a reference/s on the use of this product in case it is available.
    • The answers to your questions are as follows: 1) This recombinant protein has not been tested for any functionality; we therefore recommend that it is not used for experiments requiring activity. 2) The method of protein purification used is Glutathione Sepharose 4 Fast Flow; the tagged proteins are eluted under mild, non-denaturing conditions. 3) Here is a MCB reference for H00004904-P01 (where the manufacturer is shown as Abnova, the Taiwanese company we distribute this product for).

Additional YB1 Products

Research Areas for YB1 Recombinant Protein (H00004904-P01)

Find related products by research area.

Blogs on YB1.

Understanding ‘Y’ in Breast Cancer: Crucial Role of DNA/RNA-binding Protein YB-1 in the Development, Pre-Invasive, and Metastatic Phases
Jamshed Arslan, Pharm D, PhD In the United States, 1 in 8 women will be diagnosed with breast cancer in her lifetime.1 Despite the prevalence, cancer genesis is a mystery. The heterogeneity of cancers makes it diff...  Read full blog post.

New Techniques Using Phosphoserine Antibodies
Phosphoserine, the phosphorylated modification of the amino acid serine, is a central post-translational modification within a cell for many biological and biomedical processes. The phosphorylation of specifically four residue types - histidine, serin...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human YB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol YBX1