YAP1 Recombinant Protein Antigen

Images

 
There are currently no images for YAP1 Recombinant Protein Antigen (NBP2-38430PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

YAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YAP1.

Source: E. coli

Amino Acid Sequence: PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
YAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38430.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for YAP1 Recombinant Protein Antigen

  • 65 kDa Yes-associated protein
  • COB1
  • Protein Yorkie Homolog
  • Transcriptional Coactivator YAP1
  • YAP
  • YAP1
  • YAP1-2gamma
  • YAP2
  • YAP2L
  • YAP65
  • YAP65yes-associated protein 2
  • Yes Associated Protein
  • Yes-associated protein 1
  • Yes-associated protein 1, 65kDa
  • yes-associated protein beta
  • yes-associated protein delta
  • Yes-Associated Protein YAP65 Homolog
  • Yes-Associated Protein
  • YKI
  • Yorkie Homolog

Background

The transcriptional coactivator Yes-associated protein (YAP), also known as Yes-associated protein 1 (YAP1), Yes-Associated Protein YAP65 Homolog, Protein Yorkie Homolog and YAP65 has a theoretical molecular weight of 65 kDa. The YAP1 gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. YAP1 shares homology with the WW domain of transcriptional co-activator with PDZ-binding motif (TAZ), which functions as a transcriptional co-activator by binding to the PPXY motif present in transcription factors and is likely involved in protein-protein interaction. YAP has been identified as a core regulatory mechanism that blocks mammalian glial cell proliferation and cellular reprogramming following damage (1).

YAP plays a role in the development and progression of multiple cancers as a transcriptional regulator of the Hippo signaling pathway. YAP1 encodes a nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis to play a pivotal role in controlling cell growth and organ size and has emerged as a key player in tumor suppression (2,3). Deregulation of the Hippo pathway causes tumor formation and malignancy, with YAP being a key oncogenic driver in liver carcinogenesis (2) and may function as a potential target for cancer treatment (3).

References

1. Rueda, E. M., Hall, B. M., Hill, M. C., Swinton, P. G., Tong, X., Martin, J. F., & Poche, R. A. (2019). The Hippo Pathway Blocks Mammalian Retinal Muller Glial Cell Reprogramming. Cell Rep, 27(6), 1637-1649.e1636. doi:10.1016/j.celrep.2019.04.047

2. Liu, A. M., Xu, M. Z., Chen, J., Poon, R. T., & Luk, J. M. (2010). Targeting YAP and Hippo signaling pathway in liver cancer. Expert Opin Ther Targets, 14(8), 855-868. doi:10.1517/14728222.2010.499361

3.Ye, S., & Eisinger-Mathason, T. S. (2016). Targeting the Hippo pathway: Clinical implications and therapeutics. Pharmacol Res, 103, 270-278. doi:10.1016/j.phrs.2015.11.025

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7940
Species: Hu
Applications: IHC, WB
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, PLA, Simple Western, WB
NBP1-81763
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-197
Species: Hu, Mu
Applications: IP, WB
H00060485-M02
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48017
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-24737
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-84161
Species: Hu
Applications: IHC,  IHC-P
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-03473
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP3-46037
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, , WB
AF3254
Species: Hu, Mu, Rt
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for YAP1 Recombinant Protein Antigen (NBP2-38430PEP) (0)

There are no publications for YAP1 Recombinant Protein Antigen (NBP2-38430PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YAP1 Recombinant Protein Antigen (NBP2-38430PEP) (0)

There are no reviews for YAP1 Recombinant Protein Antigen (NBP2-38430PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for YAP1 Recombinant Protein Antigen (NBP2-38430PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional YAP1 Products

Array NBP2-38430PEP

Research Areas for YAP1 Recombinant Protein Antigen (NBP2-38430PEP)

Find related products by research area.

Blogs on YAP1.


  Read full blog post.

YAP1 - a transcription co-activator and the downstream target of Hippo pathway
YAP1 (Yes-associated protein 1) is a  transcriptional co-activator which acts as a major effector of Hippo signaling pathway that regulates organ size/ tissue homeostasis and cell proliferation, and is an established oncogene (1).  Hippo sig...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our YAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol YAP1