XYLT2 Antibody

Product Discontinued

XYLT2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to XYLT2(xylosyltransferase II) The peptide sequence was selected form the middle region of XYLT2. Peptide sequence PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW.
• Predicted Species: Mouse (100%), Rat (100%), Porcine (100%), Bovine (93%), Guinea Pig (92%), Rabbit (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XYLT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This is a rabbit polyclonal antibody against XYLT2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for XYLT2 Antibody

• EC 2.4.2.26
• Peptide O-xylosyltransferase 1
• PXYLT2
• XT2UDP-D-xylose:proteoglycan core protein beta-D-xylosyltransferase
• xylosyltransferase 2
• xylosyltransferase IIXT-IIprotein xylosyltransferase 2
• xylT-II

Background

XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XYLT2
• OMIM:
  • NP_071450(Human)
• Uniprot:
  • Q9H1B5(Human)