XTP4 Antibody - Azide and BSA Free

Western Blot: XTP4 Antibody [H00084299-B01P] - Analysis of C17orf37 expression in transfected 293T cell line by C17orf37 polyclonal antibody. Lane 1: C17orf37 transfected lysate(12.65 KDa). Lane 2: Non-transfected lysate.

Western Blot: XTP4 Antibody [H00084299-B01P] - C17orf37 MaxPab polyclonal antibody. Western Blot analysis of C17orf37 expression in human colon.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

XTP4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse XTP4 Antibody - Azide and BSA Free (H00084299-B01P) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-XTP4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: C17orf37 (NP_115715.3, 1 a.a. - 115 a.a.) full-length human protein. MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
• Specificity: C17orf37 - chromosome 17 open reading frame 37,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MIEN1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1:500
• Application Notes: Antibody reactive against tissue lysate and transfected lysate in western blot. GST tag alone is used as a negative control. May also be used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XTP4 Antibody - Azide and BSA Free

• C35
• chromosome 17 open reading frame 37
• HBV XAg-transactivated protein 4
• HBV X-transactivated gene 4 protein
• MGC14832
• ORB3
• protein C17orf37
• Protein C35
• XTP4RDX12

Background

XTP4 may be involved in a redox-related process (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for XTP4 Antibody (H00084299-B01P)(2)

Publications using H00084299-B01P

• Rajendiran S, Parwani AV, Hare RJ et al. MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1. Mol Cancer. 2014-11-19 [PMID: 25406943]
• Dasgupta S, Wasson LM, Rauniyar N et al. Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells. Oncogene 2009-06-08 [PMID: 19503095]

Bioinformatics

• Gene Symbol: MIEN1
• Entrez:
  • 84299(Human)
• Uniprot:
  • NP_115715.3(Human)