XRRA1 Antibody

Images

 
Western Blot: XRRA1 Antibody [NBP1-70749] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XRRA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to XRRA1 (X-ray radiation resistance associated 1) The peptide sequence was selected from the N terminal of XRRA1)(50ug). Peptide sequence MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XRRA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against XRRA1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for XRRA1 Antibody

  • X-ray radiation resistance associated 1

Background

XRRA1 may be involved in the response of cells to X-ray radiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP2-29487
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-16430
Species: Hu
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1393
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS

Publications for XRRA1 Antibody (NBP1-70749) (0)

There are no publications for XRRA1 Antibody (NBP1-70749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XRRA1 Antibody (NBP1-70749) (0)

There are no reviews for XRRA1 Antibody (NBP1-70749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XRRA1 Antibody (NBP1-70749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XRRA1 Products

Bioinformatics Tool for XRRA1 Antibody (NBP1-70749)

Discover related pathways, diseases and genes to XRRA1 Antibody (NBP1-70749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XRRA1 Antibody (NBP1-70749)

Discover more about diseases related to XRRA1 Antibody (NBP1-70749).
 

Pathways for XRRA1 Antibody (NBP1-70749)

View related products by pathway.

Blogs on XRRA1

There are no specific blogs for XRRA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XRRA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XRRA1