XPB Recombinant Protein Antigen

Images

 
There are currently no images for XPB Recombinant Protein Antigen (NBP2-58758PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

XPB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XPB.

Source: E. coli

Amino Acid Sequence: KLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERCC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58758.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XPB Recombinant Protein Antigen

  • Basic transcription factor 2 89 kDa subunit
  • BTF2 p89
  • BTF2
  • DNA excision repair protein ERCC-3
  • DNA repair protein complementing XP-B cells
  • EC 3.6.1
  • EC 3.6.4.12
  • ERCC3
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing)
  • GTF2H
  • RAD25
  • TFIIH basal transcription factor complex 89 kDa subunit
  • TFIIH basal transcription factor complex helicase XPB subunit
  • TFIIH p89
  • TFIIH
  • Xeroderma pigmentosum group B-complementing protein
  • xeroderma pigmentosum, complementation group B
  • XPB
  • XPBC
  • XPBTFIIH 89 kDa subunit

Background

ERCC3 is a component of the core TFIIH basal transcription factor and functions as an ATP-dependent 3'-5' DNA helicase. ERCC3 is involved in nucleotide excision repair and is the cause of xeroderma pigmentosum complementation group B (XPB), also known as xeroderma pigmentosum II (XP2). Additionally, it has been found to be the cuase of Cockayne syndrome, and trichothiodystrophy (TTD). XPB is an autosomal recessive disease characterized by skin photosensitivity and a predisposition to skin cancer, and neurological abnormalities. Cockayne syndrome and TTD are similarly characterized by photosensitivity and neural abnormalities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15704
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-581
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
H00000902-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF3416
Species: Hu
Applications: WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-32405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
AF2396
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-15275
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for XPB Recombinant Protein Antigen (NBP2-58758PEP) (0)

There are no publications for XPB Recombinant Protein Antigen (NBP2-58758PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPB Recombinant Protein Antigen (NBP2-58758PEP) (0)

There are no reviews for XPB Recombinant Protein Antigen (NBP2-58758PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XPB Recombinant Protein Antigen (NBP2-58758PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XPB Products

Array NBP2-58758PEP

Research Areas for XPB Recombinant Protein Antigen (NBP2-58758PEP)

Find related products by research area.

Blogs on XPB

There are no specific blogs for XPB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XPB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC3