![Immunohistochemistry-Paraffin: XE7 Antibody [NBP1-92599] - Staining of human spleen shows high expression.](http://images.novusbio.com/fullsize/XE7-Antibody-Immunohistochemistry-Paraffin-NBP1-92599-img0004.jpg "Immunohistochemistry-Paraffin: XE7 Antibody [NBP1-92599] - Staining of human spleen shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit XE7 Antibody - BSA Free (NBP1-92599) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AKAP17A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AKAP17A |
![Immunohistochemistry-Paraffin: XE7 Antibody [NBP1-92599] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/XE7-Antibody-Immunohistochemistry-Paraffin-NBP1-92599-img0002.jpg "Immunohistochemistry-Paraffin: XE7 Antibody [NBP1-92599] - Staining of human colon shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: XE7 Antibody [NBP1-92599] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/XE7-Antibody-Immunohistochemistry-Paraffin-NBP1-92599-img0003.jpg "Immunohistochemistry-Paraffin: XE7 Antibody [NBP1-92599] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: XE7 Antibody [NBP1-92599] - Staining in human spleen and skeletal muscle tissues using anti-AKAP17A antibody. Corresponding AKAP17A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/XE7-Antibody-Immunohistochemistry-Paraffin-NBP1-92599-img0005.jpg "Immunohistochemistry-Paraffin: XE7 Antibody [NBP1-92599] - Staining in human spleen and skeletal muscle tissues using anti-AKAP17A antibody. Corresponding AKAP17A RNA-seq data are presented for the same tissues.")
![Flow Cytometry CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Flow_Cytometry_8220.jpg)
![Western Blot CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Western_Blot_23993.jpg)
![Simple Western CD99 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD99_AF3968_Simple_Western_24089.jpg)
![Immunocytochemistry GM-CSFR alpha Antibody (698423) [Unconjugated]](https://images.novusbio.com/images2/GM-CSF_R_alpha_MAB6130_Immunocytochemistry_11149.jpg)
![Flow Cytometry GM-CSFR alpha Antibody (698423) [Unconjugated]](https://images.novusbio.com/images2/GM-CSF_R_alpha_MAB6130_Flow_Cytometry_11215.jpg)
![Neutralization GM-CSFR alpha Antibody (698423) [Unconjugated]](https://images.novusbio.com/images2/GM-CSF_R_alpha_MAB6130_Block_Neutralize_11320.jpg)
![Immunohistochemistry Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Immunohistochemistry_24138.jpg)
![Western Blot Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Western_Blot_20441.jpg)
![Simple Western Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Simple_Western_20573.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")