Recombinant Human XBP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human XBP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-261 of Human XBP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
XBP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human XBP1 Protein

  • HTF
  • TREB5
  • X-box binding protein 1
  • X-box-binding protein 1
  • XBP1
  • XBP-1
  • XBP2
  • XBP2Tax-responsive element-binding protein 5

Background

This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1). The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1(S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1(U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1(S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1543
Species: Hu
Applications: WB, IHC
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-83092
Species: Hu
Applications: IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-01787
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for XBP1 Recombinant Protein (H00007494-P01) (0)

There are no publications for XBP1 Recombinant Protein (H00007494-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XBP1 Recombinant Protein (H00007494-P01) (0)

There are no reviews for XBP1 Recombinant Protein (H00007494-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XBP1 Recombinant Protein (H00007494-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XBP1 Products

Bioinformatics Tool for XBP1 Recombinant Protein (H00007494-P01)

Discover related pathways, diseases and genes to XBP1 Recombinant Protein (H00007494-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XBP1 Recombinant Protein (H00007494-P01)

Discover more about diseases related to XBP1 Recombinant Protein (H00007494-P01).
 

Pathways for XBP1 Recombinant Protein (H00007494-P01)

View related products by pathway.

PTMs for XBP1 Recombinant Protein (H00007494-P01)

Learn more about PTMs related to XBP1 Recombinant Protein (H00007494-P01).
 

Research Areas for XBP1 Recombinant Protein (H00007494-P01)

Find related products by research area.

Blogs on XBP1.

Analysis of Total & pSer724 IRE1 alpha, the Sensor of ER Stress
Inositol-requiring protein 1/IRE1 alpha (also called Endoplasmic Reticulum to Nucleus Signaling 1/ERN1; predicted mol wt 110 kDa) is a serine-threonine protein kinase/endoribonuclease which plays a highly critical role in unfolded protein response/U...  Read full blog post.

IRE1 - an important sensor in the unfolded protein response pathway
During cellular stress the protein folding capacity of the ER is diminished. In order to maintain homeostasis and ensure proper protein folding cells activate the unfolded protein response (UPR), a signaling network consisting of sensors and effect...  Read full blog post.

Customers Who Bought This Also Bought

XBP1 Blocking Peptide
NBP1-77252PEP
XBP1 Antibody
NB100-80861
ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human XBP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol XBP1
Entrez