WSTF Antibody (5E9)

Images

 
Immunohistochemistry-Paraffin: WSTF Antibody (5E9) [H00009031-M01] - Analysis of monoclonal antibody to BAZ1B on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Proximity Ligation Assay: WSTF Antibody (5E9) [H00009031-M01] - Analysis of protein-protein interactions between SMARCB1 and BAZ1B. HeLa cells were stained with anti-SMARCB1 rabbit purified polyclonal 1:1200 and ...read more
Proximity Ligation Assay: WSTF Antibody (5E9) [H00009031-M01] - Analysis of protein-protein interactions between SMARCB1 and BAZ1B. Huh7 cells were stained with anti-SMARCB1 rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: WSTF Antibody (5E9) [H00009031-M01] - Detection limit for recombinant GST tagged BAZ1B is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, Func, IHC
Clone
5E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

WSTF Antibody (5E9) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
BAZ1B (NP_075381, 1384 a.a. ~ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK
Localization
Nuclear
Specificity
BAZ1B - bromodomain adjacent to zinc finger domain, 1B
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BAZ1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WSTF Antibody (5E9)

  • bromodomain adjacent to zinc finger domain, 1B
  • williams-Beuren syndrome chromosomal region 10 protein

Background

WSTF (Williams syndrome transcription factor) is a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. WSTF forms a chromatin remodeling complex that mobilizes nucleosomes and reconfigures irregular chromatin to a regular nucleosomal array structure. This gene is deleted in Williams-Beuren syndrome, a developmental disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-55310
Species: Hu, Mu
Applications: IP, WB
NB100-61041
Species: Hu
Applications: IP, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
PP-H4537-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NBP1-87745
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-91988
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB7650
Species: Mu
Applications: IHC, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-92158
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-38740
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-61050
Species: Hu
Applications: IHC, IHC-P, IP, PLA, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for WSTF Antibody (H00009031-M01) (0)

There are no publications for WSTF Antibody (H00009031-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WSTF Antibody (H00009031-M01) (0)

There are no reviews for WSTF Antibody (H00009031-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WSTF Antibody (H00009031-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WSTF Products

Array H00009031-M01

Diseases for WSTF Antibody (H00009031-M01)

Discover more about diseases related to WSTF Antibody (H00009031-M01).
 

Pathways for WSTF Antibody (H00009031-M01)

View related products by pathway.

PTMs for WSTF Antibody (H00009031-M01)

Learn more about PTMs related to WSTF Antibody (H00009031-M01).
 

Research Areas for WSTF Antibody (H00009031-M01)

Find related products by research area.

Blogs on WSTF

There are no specific blogs for WSTF, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WSTF Antibody (5E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol BAZ1B
Entrez
OMIM