WSTF Antibody (5E9) Summary
Immunogen |
BAZ1B (NP_075381, 1384 a.a. ~ 1483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK |
Localization |
Nuclear |
Specificity |
BAZ1B - bromodomain adjacent to zinc finger domain, 1B |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
BAZ1B |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Proximity Ligation Assay
- Sandwich ELISA
|
Application Notes |
Antibody reactivity against recombinant protein on ELISA. It has been used for IHC-P. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for WSTF Antibody (5E9)
Background
WSTF (Williams syndrome transcription factor) is a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. WSTF forms a chromatin remodeling complex that mobilizes nucleosomes and reconfigures irregular chromatin to a regular nucleosomal array structure. This gene is deleted in Williams-Beuren syndrome, a developmental disorder.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: IHC, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for WSTF Antibody (H00009031-M01) (0)
There are no publications for WSTF Antibody (H00009031-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for WSTF Antibody (H00009031-M01) (0)
There are no reviews for WSTF Antibody (H00009031-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for WSTF Antibody (H00009031-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional WSTF Products
Bioinformatics Tool for WSTF Antibody (H00009031-M01)
Discover related pathways, diseases and genes to WSTF Antibody (H00009031-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for WSTF Antibody (H00009031-M01)
Discover more about diseases related to WSTF Antibody (H00009031-M01).
| | Pathways for WSTF Antibody (H00009031-M01)
View related products by pathway.
|
PTMs for WSTF Antibody (H00009031-M01)
Learn more about PTMs related to WSTF Antibody (H00009031-M01).
| | Research Areas for WSTF Antibody (H00009031-M01)
Find related products by research area.
|
Blogs on WSTF