WRCH1 Antibody


Western Blot: WRCH1 Antibody [NBP1-58350] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

WRCH1 Antibody Summary

Synthetic peptides corresponding to RHOU(ras homolog gene family, member U) The peptide sequence was selected from the C terminal of RHOU. Peptide sequence LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RHOU and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for WRCH1 Antibody

  • ARHU
  • CDC42L1GTP-binding protein-like 1
  • DJ646B12.2
  • fJ646B12.2
  • FLJ10616,2310026M05Rik
  • G28K
  • GTP-binding protein like 1
  • GTP-binding protein SB128
  • hG28K
  • ras homolog gene family, member U
  • ras-like gene family member U
  • Rho GTPase-like protein ARHU
  • rho-related GTP-binding protein RhoU
  • Ryu GTPase
  • Wnt-1 responsive Cdc42 homolog 1
  • WRCH-1
  • WRCH1CDC42-like GTPase 1


RHOU is a member of the Rho family of GTPases. It can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu

Publications for WRCH1 Antibody (NBP1-58350) (0)

There are no publications for WRCH1 Antibody (NBP1-58350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WRCH1 Antibody (NBP1-58350) (0)

There are no reviews for WRCH1 Antibody (NBP1-58350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WRCH1 Antibody (NBP1-58350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for WRCH1 Antibody (NBP1-58350)

Discover related pathways, diseases and genes to WRCH1 Antibody (NBP1-58350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WRCH1 Antibody (NBP1-58350)

Discover more about diseases related to WRCH1 Antibody (NBP1-58350).

Pathways for WRCH1 Antibody (NBP1-58350)

View related products by pathway.

PTMs for WRCH1 Antibody (NBP1-58350)

Learn more about PTMs related to WRCH1 Antibody (NBP1-58350).

Research Areas for WRCH1 Antibody (NBP1-58350)

Find related products by research area.

Blogs on WRCH1

There are no specific blogs for WRCH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WRCH1 Antibody and receive a gift card or discount.


Gene Symbol RHOU