Wnt-10a Antibody

Images

 
Western Blot: Wnt-10a Antibody [NBP1-86081] - Analysis in control (vector only transfected HEK293T lysate) and wNT10A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Wnt-10a Antibody [NBP1-86081] - Staining of human skin shows weak cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt-10a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YESPIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT10A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Wnt-10a Protein (NBP1-86081PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Wnt-10a Antibody

  • FLJ14301
  • protein Wnt-10a
  • SSPS
  • wingless-type MMTV integration site family, member 10A
  • Wnt10a
  • Wnt-10a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7196-WN/CF
Species: Hu
3669-WN/CF
Species: Mu
AF4109
Species: Hu
Applications: WB, IHC
3900-WN/CF
Species: Mu
NBP2-46367
Species: Hu
Applications: WB, IHC
AF3157
Species: Hu
Applications: WB, IHC
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15163
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2248
Species: Mu
Applications: WB, IHC
AF3367
Species: Hu, Mu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF1620
Species: Mu
Applications: WB, IHC
3008-WN/CF
Species: Hu
AF475
Species: Mu
Applications: WB, IHC
645-WN/CF
Species: Hu, Mu
46780002
Species: Hu
Applications: ELISA
NBP1-86081
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Wnt-10a Antibody (NBP1-86081) (0)

There are no publications for Wnt-10a Antibody (NBP1-86081).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-10a Antibody (NBP1-86081) (0)

There are no reviews for Wnt-10a Antibody (NBP1-86081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-10a Antibody (NBP1-86081) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-10a Products

Bioinformatics Tool for Wnt-10a Antibody (NBP1-86081)

Discover related pathways, diseases and genes to Wnt-10a Antibody (NBP1-86081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-10a Antibody (NBP1-86081)

Discover more about diseases related to Wnt-10a Antibody (NBP1-86081).
 

Pathways for Wnt-10a Antibody (NBP1-86081)

View related products by pathway.

PTMs for Wnt-10a Antibody (NBP1-86081)

Learn more about PTMs related to Wnt-10a Antibody (NBP1-86081).

Blogs on Wnt-10a

There are no specific blogs for Wnt-10a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-10a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT10A
Entrez