Wnt-10a Antibody

Images

 
Western Blot: Wnt-10a Antibody [NBP1-69116] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.
Immunohistochemistry-Paraffin: Wnt-10a Antibody [NBP1-69116] - Human testis tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt-10a Antibody Summary

Immunogen
Synthetic peptides corresponding to Wnt10a (wingless related MMTV integration site 10a) The peptide sequence was selected from the middle region of Wnt10a. Peptide sequence RDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT10A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Wnt10a and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-69116 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Wnt-10a Antibody

  • FLJ14301
  • protein Wnt-10a
  • SSPS
  • wingless-type MMTV integration site family, member 10A
  • Wnt10a
  • Wnt-10a

Background

Wnt10a is the ligand for members of the frizzled family of seven transmembrane receptors. Wnt10a is a probable developmental protein. Wnt10a may be a signaling molecule important in CNS development. Wnt10a is likely to signal over only few cell diameters.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7196-WN/CF
Species: Hu
3669-WN/CF
Species: Mu
AF4109
Species: Hu
Applications: WB, IHC
3900-WN/CF
Species: Mu
NBP2-46367
Species: Hu
Applications: WB, IHC
AF3157
Species: Hu
Applications: WB, IHC
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15163
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2248
Species: Mu
Applications: WB, IHC
AF3367
Species: Hu, Mu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF1620
Species: Mu
Applications: WB, IHC
3008-WN/CF
Species: Hu
AF475
Species: Mu
Applications: WB, IHC
645-WN/CF
Species: Hu, Mu
46780002
Species: Hu
Applications: ELISA
NBP1-69116
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Wnt-10a Antibody (NBP1-69116)(1)

We have publications tested in 1 confirmed species: Rabbit.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rabbit
(1)
All Species

Reviews for Wnt-10a Antibody (NBP1-69116) (0)

There are no reviews for Wnt-10a Antibody (NBP1-69116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-10a Antibody (NBP1-69116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-10a Products

Bioinformatics Tool for Wnt-10a Antibody (NBP1-69116)

Discover related pathways, diseases and genes to Wnt-10a Antibody (NBP1-69116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-10a Antibody (NBP1-69116)

Discover more about diseases related to Wnt-10a Antibody (NBP1-69116).
 

Pathways for Wnt-10a Antibody (NBP1-69116)

View related products by pathway.

PTMs for Wnt-10a Antibody (NBP1-69116)

Learn more about PTMs related to Wnt-10a Antibody (NBP1-69116).

Blogs on Wnt-10a

There are no specific blogs for Wnt-10a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-10a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT10A
Entrez