Wnt-10a Antibody - BSA Free

Western Blot: Wnt-10a Antibody [NBP1-69116] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Immunohistochemistry-Paraffin: Wnt-10a Antibody [NBP1-69116] - Human testis tissue at an antibody concentration of 4-8ug/ml.

• Reactivity: Hu, Rb
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Wnt-10a Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to Wnt10a (wingless related MMTV integration site 10a) The peptide sequence was selected from the middle region of Wnt10a. Peptide sequence RDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNT10A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Rabbit reactivity reported in scientific literature (PMID: 25524027).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Wnt-10a Antibody - BSA Free

• FLJ14301
• protein Wnt-10a
• SSPS
• wingless-type MMTV integration site family, member 10A
• Wnt10a
• Wnt-10a

Background

Wnt10a is the ligand for members of the frizzled family of seven transmembrane receptors. Wnt10a is a probable developmental protein. Wnt10a may be a signaling molecule important in CNS development. Wnt10a is likely to signal over only few cell diameters.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Wnt-10a Antibody (NBP1-69116)(2)

Publications using NBP1-69116

• Kao YH, Igarashi N, Abduweli Uyghurturk D et al. Fluoride Alters Signaling Pathways Associated with the Initiation of Dentin Mineralization in Enamel Fluorosis Susceptible Mice Biol Trace Elem Res 2020-10-28 [PMID: 33113116]
• Lee S, Zheng Z, Kang J et al. Therapeutic efficacy of autologous platelet-rich plasma and polydeoxyribonucleotide on female pattern hair loss. Wound Repair Regen. 2014-12-18 [PMID: 25524027] (WB, Rabbit)

Bioinformatics

• Gene Symbol: WNT10A