WHSC2 Recombinant Protein Antigen

Images

 
There are currently no images for WHSC2 Protein (NBP2-38454PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WHSC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WHSC2.

Source: E. coli

Amino Acid Sequence: LSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NELFA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38454.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WHSC2 Recombinant Protein Antigen

  • FLJ10442
  • negative elongation factor A
  • NELFA
  • NELF-AFLJ25112
  • Wolf-Hirschhorn syndrome candidate 2 protein
  • Wolf-Hirschhorn syndrome candidate 2

Background

WHSC2 is expressed ubiquitously with higher levels in fetal than in adult tissues. It encodes a protein sharing 93% sequence identity with the mouse protein. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene is mapped to the 165 kb WHS critical region, and may play a role in the phenotype of the WHS or Pitt-Rogers-Danks syndrome. The encoded protein is found to be capable of reacting with HLA-A2-restricted and tumor-specific cytotoxic T lymphocytes, suggesting a target for use in specific immunotherapy for a large number of cancer patients. This protein has also been shown to be a member of the NELF (negative elongation factor) protein complex that participates in the regulation of RNA polymerase II transcription elongation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52963
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92175
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-16475
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-83508
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
H00003954-M03
Species: Hu, Mu
Applications: ELISA, Func, ICC/IF, IHC,  IHC-P, IP, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-82924
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83290
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-34143
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
H00006827-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-37357
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NB100-402
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB

Publications for WHSC2 Protein (NBP2-38454PEP) (0)

There are no publications for WHSC2 Protein (NBP2-38454PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WHSC2 Protein (NBP2-38454PEP) (0)

There are no reviews for WHSC2 Protein (NBP2-38454PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WHSC2 Protein (NBP2-38454PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WHSC2 Products

Research Areas for WHSC2 Protein (NBP2-38454PEP)

Find related products by research area.

Blogs on WHSC2

There are no specific blogs for WHSC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WHSC2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NELFA