SUPT5H Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SUPT5H Antibody [NBP1-83508] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

ChIP-Exo-Seq composite graph for Anti-SUPT5H (NBP1-83508) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Western Blot: SUPT5H Antibody [NBP1-83508] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Western Blot: SUPT5H Antibody [NBP1-83508] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-560

Analysis in human testis and pancreas tissues using Anti-SUPT5H antibody. Corresponding SUPT5H RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining of human testis shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUPT5H Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUPT5H Antibody - BSA Free (NBP1-83508) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SUPT5H Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUPT5H
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SUPT5H Protein (NBP1-83508PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22864569)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SUPT5H Antibody - BSA Free

• DRB sensitivity-inducing factor 160 kDa subunit
• DRB sensitivity-inducing factor large subunit
• DSIF large subunit
• DSIF p160
• FLJ34157
• SPT5hSPT5
• SPT5HTat-cotransactivator 1 protein
• suppressor of Ty (S.cerevisiae) 5 homolog
• suppressor of Ty 5 homolog (S. cerevisiae)
• Tat-CT1 protein
• Tat-CT1
• transcription elongation factor SPT5

Background

SUPT5H is a component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SUPT5H Antibody (NBP1-83508)(1)

Publication using NBP1-83508

• Arabi A, Ullah K, Branca RM et al. Proteomic screen reveals Fbw7 as a modulator of the NF-kappa pathway. Nat Commun 2012-01-01 [PMID: 22864569]

Bioinformatics

• Gene Symbol: SUPT5H
• Entrez:
  • 6829(Human)
• Uniprot:
  • O00267(Human)