SUPT5H Antibody

Images

 
Western Blot: SUPT5H Antibody [NBP1-83508] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SUPT5H Antibody [NBP1-83508] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SUPT5H Antibody [NBP1-83508] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Western Blot: SUPT5H Antibody [NBP1-83508] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-560

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUPT5H Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUPT5H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUPT5H Protein (NBP1-83508PEP)
Publications
Read Publication using NBP1-83508.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22864569)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUPT5H Antibody

  • DRB sensitivity-inducing factor 160 kDa subunit
  • DRB sensitivity-inducing factor large subunit
  • DSIF large subunit
  • DSIF p160
  • FLJ34157
  • SPT5hSPT5
  • SPT5HTat-cotransactivator 1 protein
  • suppressor of Ty (S.cerevisiae) 5 homolog
  • suppressor of Ty 5 homolog (S. cerevisiae)
  • Tat-CT1 protein
  • Tat-CT1
  • transcription elongation factor SPT5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006827-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92175
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86966
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
NB600-273
Species: Hu, Mu, Rt
Applications: WB
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-93707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006920-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUPT5H Antibody (NBP1-83508)(1)


Reviews for SUPT5H Antibody (NBP1-83508) (0)

There are no reviews for SUPT5H Antibody (NBP1-83508). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUPT5H Antibody (NBP1-83508) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUPT5H Products

Bioinformatics Tool for SUPT5H Antibody (NBP1-83508)

Discover related pathways, diseases and genes to SUPT5H Antibody (NBP1-83508). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUPT5H Antibody (NBP1-83508)

Discover more about diseases related to SUPT5H Antibody (NBP1-83508).
 

Pathways for SUPT5H Antibody (NBP1-83508)

View related products by pathway.

PTMs for SUPT5H Antibody (NBP1-83508)

Learn more about PTMs related to SUPT5H Antibody (NBP1-83508).

Blogs on SUPT5H

There are no specific blogs for SUPT5H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUPT5H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUPT5H
Entrez
Uniprot