WHAMM Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WHAMM Antibody [NBP1-89593] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: WHAMM Antibody [NBP1-89593] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WHAMM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EELKVIDCVVGLQDDKNLEVKELRRQCQQLESKRGRICAKRASLRSRKDQCKENHRFRLQQAEESIRYSRQHH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WHAMM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WHAMM Protein (NBP1-89593PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WHAMM Antibody

  • WASP homolog-associated protein with actin, membranes and microtubules
  • WHDC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30464
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NB100-2307
Species: Hu
Applications: WB
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP2-49510
Species: Hu
Applications: WB, IHC
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF674
Species: Hu
Applications: WB, Simple Western, Neut
NBL1-17846
Species: Hu
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89593
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for WHAMM Antibody (NBP1-89593) (0)

There are no publications for WHAMM Antibody (NBP1-89593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WHAMM Antibody (NBP1-89593) (0)

There are no reviews for WHAMM Antibody (NBP1-89593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WHAMM Antibody (NBP1-89593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WHAMM Products

WHAMM NBP1-89593

Bioinformatics Tool for WHAMM Antibody (NBP1-89593)

Discover related pathways, diseases and genes to WHAMM Antibody (NBP1-89593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WHAMM Antibody (NBP1-89593)

Discover more about diseases related to WHAMM Antibody (NBP1-89593).
 

Pathways for WHAMM Antibody (NBP1-89593)

View related products by pathway.

Blogs on WHAMM

There are no specific blogs for WHAMM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WHAMM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WHAMM