WDR9 Recombinant Protein Antigen

Images

 
There are currently no images for WDR9 Protein (NBP2-38168PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WDR9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRWD1.

Source: E.coli

Amino Acid Sequence: SHIPGSETDRTFSSESTLAQKATAENNFEVELNYGLRRWNGRRLRTYGKAPFSKTKVIHDSQETAEKEVKRKRSHPELENVKISETTG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BRWD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38168.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for WDR9 Recombinant Protein Antigen

  • bromodomain and WD repeat domain containing 1
  • bromodomain and WD repeat-containing protein 1
  • C21orf107
  • chromosome 21 open reading frame 107
  • FLJ11315
  • FLJ43918
  • N143
  • transcriptional unit N143
  • WD repeat domain 9
  • WD repeat protein WDR9-form2
  • WD repeat-containing protein 9
  • WDR9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
NBP2-04014
Species: Hu
Applications: WB, IP
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88435
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84492
Species: Hu
Applications: WB, IHC, IHC-P
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50113
Species: Hu
Applications: WB, ICC/IF, IHC, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WDR9 Protein (NBP2-38168PEP) (0)

There are no publications for WDR9 Protein (NBP2-38168PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR9 Protein (NBP2-38168PEP) (0)

There are no reviews for WDR9 Protein (NBP2-38168PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for WDR9 Protein (NBP2-38168PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for WDR9 Protein (NBP2-38168PEP)

Discover related pathways, diseases and genes to WDR9 Protein (NBP2-38168PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR9 Protein (NBP2-38168PEP)

Discover more about diseases related to WDR9 Protein (NBP2-38168PEP).
 

Pathways for WDR9 Protein (NBP2-38168PEP)

View related products by pathway.

Blogs on WDR9

There are no specific blogs for WDR9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WDR9 Antibody
NBP1-89878

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WDR9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BRWD1