WDR79 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WDR79 Antibody [NBP2-56099] - Staining of human cell line U-251 MG shows localization to nuclear bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR79 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT
Specificity
Specificity of human WDR79 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WRAP53
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDR79 Recombinant Protein Antigen (NBP2-56099PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for WDR79 Antibody

  • FLJ10385
  • TCAB1WDR79telomerase Cajal body protein 1
  • WD repeat containing, antisense to TP53
  • WD repeat domain 79
  • WD repeat-containing protein 79
  • WD40 protein Wrap53
  • WD40 repeat-containing protein encoding RNA antisense to p53
  • WD-encoding RNA antisense to p53

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-317
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13656
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55709
Species: Hu
Applications: WB, ICC/IF
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-31742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97768
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF5489
Species: Hu
Applications: WB, IHC
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for WDR79 Antibody (NBP2-56099) (0)

There are no publications for WDR79 Antibody (NBP2-56099).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR79 Antibody (NBP2-56099) (0)

There are no reviews for WDR79 Antibody (NBP2-56099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WDR79 Antibody (NBP2-56099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR79 Products

Bioinformatics Tool for WDR79 Antibody (NBP2-56099)

Discover related pathways, diseases and genes to WDR79 Antibody (NBP2-56099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR79 Antibody (NBP2-56099)

Discover more about diseases related to WDR79 Antibody (NBP2-56099).
 

Pathways for WDR79 Antibody (NBP2-56099)

View related products by pathway.

Research Areas for WDR79 Antibody (NBP2-56099)

Find related products by research area.

Blogs on WDR79

There are no specific blogs for WDR79, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR79 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WRAP53