![Western Blot: WDR6 Antibody [NBP2-93695] - Western blot analysis of extracts of SH-SY5Y cells, using WDR6 antibody (NBP2-93695) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/WDR6 Antibody-Western Blot-NBP2-93695-img0002.jpg "Western Blot: WDR6 Antibody [NBP2-93695] - Western blot analysis of extracts of SH-SY5Y cells, using WDR6 antibody (NBP2-93695) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit WDR6 Antibody - Azide and BSA Free (NBP2-93695) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 800-1000 of human WDR6 (NP_060501.3). VCNHISSVRAVAVWGIGTPGGPQDPQPGLTAHVVSAGGRAEMHCFSIMVTPDPSTPSRLACHVMHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WDR6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 121 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WDR6 |
![Immunocytochemistry/Immunofluorescence: WDR6 Antibody [NBP2-93695] - Immunofluorescence analysis of NIH/3T3 cells using WDR6 Rabbit pAb (NBP2-93695) at dilution of 1:250 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/WDR6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93695-img0001.jpg "Immunocytochemistry/Immunofluorescence: WDR6 Antibody [NBP2-93695] - Immunofluorescence analysis of NIH/3T3 cells using WDR6 Rabbit pAb (NBP2-93695) at dilution of 1:250 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Western_Blot_13865.jpg)
![Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Immunohistochemistry_13917.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")