WDR46 Antibody - BSA Free

Western Blot: WDR46 Antibody [NBP2-83760] - Host: Rabbit. Target Name: WDR46. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WDR46 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WDR46 Antibody - BSA Free (NBP2-83760) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR46. Peptide sequence: VDVISLEQGKKEQIERLGYDPQAKAPFQPKPKQKGRSSTASLVKRKRKVM The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR46
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WDR46 Antibody - BSA Free

• BING4FP221
• C6orf11
• chromosome 6 open reading frame 11
• WD repeat domain 46
• WD repeat-containing protein 46
• WD repeat-containing protein BING4

Background

WDR46 was originally identified as BING-4, a protein encoded in a gene-rich region of the major histocompatibility complex (MHC). WDR46 has been found to be overexpressed in a subset of melanoma cell lines and is a cancer antigen recognized by lymphocytes. WDR46 bears six WD repeats. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD proteins are involved in a variety of cellular processes. The function of WDR46 has not been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR46