WDR11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WDR11 Antibody [NBP1-89930] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: WDR11 Antibody [NBP1-89930] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILILDLEVNQTVGVIAIERTGVPFLQVIPCFQRDGLFCLHENGCITLRVRRSYNNIFTTSNEEPDPDPVQELTYDLRSQCD
• Predicted Species: Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID:34413497).
• Control Peptide:

  WDR11 Protein (NBP1-89930PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR11 Antibody - BSA Free

• Bromodomain and WD repeat-containing protein 2
• BRWD2DKFZp434L1715
• DR11
• FLJ10506
• FLJ42531
• KIAA1351bromodomain and WD repeat domain containing 2
• WD repeat domain 11
• WD repeat domain 15
• WD repeat-containing protein 11
• WD repeat-containing protein 15
• WDR15

Background

The BRWD2 gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR11 Antibody (NBP1-89930)(1)

Publication using NBP1-89930

• Haag N, Tan EC, Begemann M Et al. Biallelic loss-of-function variants in WDR11 are associated with microcephaly and intellectual disability European journal of human genetics : EJHG 2021-08-20 [PMID: 34413497] (WB, Human)

Bioinformatics

• Gene Symbol: WDR11