![Western Blot: WDFY4 Antibody [NBP2-93284] - Analysis of extracts of HeLa cells, using WDFY4 at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/WDFY4-Antibody-Western-Blot-NBP2-93284-img0001.jpg "Western Blot: WDFY4 Antibody [NBP2-93284] - Analysis of extracts of HeLa cells, using WDFY4 at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit WDFY4 Antibody - Azide and BSA Free (NBP2-93284) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human WDFY4 (NP_065996.1). MEAEDLSKAEDRNEDPGSKNEGQLAAVQPDVPHGGQSSSPTALWDMLERKFLEYQQLTHKSPIERQKSLLSLLPLFLKAWEHSVGIICFPSLQRLAEDVSDQLAQQLQKALVGKPAEQARLAAGQLLWWKGDVDQDGYLLLKSVYVLTGTDSETLGRVAE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WDFY4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for WDFY4 Antibody (NBP2-93284)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WDFY4 |
![Immunocytochemistry OX40 Ligand/TNFSF4 Antibody (159403) [Unconjugated]](https://images.novusbio.com/images2/OX40_Ligand_MAB10541_Immunocytochemistry_10144.jpg)
![Flow Cytometry OX40 Ligand/TNFSF4 Antibody (159403) [Unconjugated]](https://images.novusbio.com/images2/OX40_Ligand_MAB10541_Flow_Cytometry_8321.jpg)
![Neutralization OX40 Ligand/TNFSF4 Antibody (159403) [Unconjugated]](https://images.novusbio.com/images2/OX40_Ligand_MAB10541_Block_Neutralize_8999.jpg)
![Western Blot STAT4 [p Tyr693] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT4_AF4319_Western_Blot_5439.jpg)
![Western Blot Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Western_Blot_5594.jpg)
![Chromatin Immunoprecipitation (ChIP) Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Chromatin_Immunoprecipitation_11241.jpg)
![Simple Western Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Simple_Western_16946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")