Novus Biologicals products are now on bio-techne.com

WDFY4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WDFY4 Antibody [NBP1-90743] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: WDFY4 Antibody [NBP1-90743] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WDFY4 Antibody [NBP1-90743] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: WDFY4 Antibody [NBP1-90743] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: WDFY4 Antibody [NBP1-90743] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDFY4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VMDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDSLDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDFY4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
WDFY4 Protein (NBP1-90743PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDFY4 Antibody

  • C10orf64
  • MGC45899
  • WDFY family member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB10541
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP1-83813
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5117
Species: Hu
Applications: IHC, WB
NBP1-88714
Species: Hu
Applications: IHC, IHC-P
H00000640-M02
Species: Hu, Mu, Rt
Applications: ELISA, Flow, WB
NBP2-24495
Species: Hu, Pm
Applications: ICC/IF, IHC, WB
NB100-1092
Species: Hu, Mu
Applications: ChIP, Flow, PEP-ELISA, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-82689
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-03024
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-20403
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85724
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00001663-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP3-26149
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-90743
Species: Hu
Applications: ICC/IF, IHC

Publications for WDFY4 Antibody (NBP1-90743) (0)

There are no publications for WDFY4 Antibody (NBP1-90743).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDFY4 Antibody (NBP1-90743) (0)

There are no reviews for WDFY4 Antibody (NBP1-90743). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WDFY4 Antibody (NBP1-90743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDFY4 Products

Array NBP1-90743

Research Areas for WDFY4 Antibody (NBP1-90743)

Find related products by research area.

Blogs on WDFY4

There are no specific blogs for WDFY4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDFY4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDFY4