Recombinant Human WDFY2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WDFY2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 400 of Human WDFY2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
WDFY2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WDFY2 Protein

  • propeller-FYVE protein
  • RP11-147H23.1
  • WD repeat and FYVE domain containing 2
  • WD repeat and FYVE domain-containing protein 2
  • WD40 and FYVE domain containing 2
  • WD40- and FYVE domain-containing protein 2
  • WDF2
  • ZFYVE22PROF
  • Zinc finger FYVE domain-containing protein 22

Background

This gene encodes a protein that contains two WD domains and an FYVE zinc finger region. The function of this gene is unknown. An alternatively spliced transcript variant of this gene may exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
H00001297-T01
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-33137
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WDFY2 Recombinant Protein (H00115825-P01) (0)

There are no publications for WDFY2 Recombinant Protein (H00115825-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDFY2 Recombinant Protein (H00115825-P01) (0)

There are no reviews for WDFY2 Recombinant Protein (H00115825-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDFY2 Recombinant Protein (H00115825-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDFY2 Products

Bioinformatics Tool for WDFY2 Recombinant Protein (H00115825-P01)

Discover related pathways, diseases and genes to WDFY2 Recombinant Protein (H00115825-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDFY2 Recombinant Protein (H00115825-P01)

Discover more about diseases related to WDFY2 Recombinant Protein (H00115825-P01).
 

Pathways for WDFY2 Recombinant Protein (H00115825-P01)

View related products by pathway.

PTMs for WDFY2 Recombinant Protein (H00115825-P01)

Learn more about PTMs related to WDFY2 Recombinant Protein (H00115825-P01).

Blogs on WDFY2

There are no specific blogs for WDFY2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATP7b Antibody
NB100-360
WDFY2 RNAi
H00115825-R01-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WDFY2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WDFY2